PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00033358-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family HSF
Protein Properties Length: 279aa    MW: 30694.4 Da    PI: 5.6971
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00033358-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind75.21.2e-231580267
                      HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE--- CS
      HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkd 67
                      Fl+++y++++d +++ ++sws ++nsf+v++++ef+  +Lp+yFkh+nf+SFvRQLn+Y +  + +
  PSME_00033358-RA 15 FLTRTYDMVDDLATNAMVSWSPSSNSFIVWNPTEFSGVLLPTYFKHNNFSSFVRQLNTYFWPYIPS 80
                      9********************999***********************************8766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.108.3E-267109IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004152.2E-2711135IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467855.17E-211382IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004471.2E-191581IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.0E-141538IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.0E-145365IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.0E-146678IPR000232Heat shock factor (HSF)-type, DNA-binding
PROSITE profilePS5123012.978196265IPR004953EB1, C-terminal
SuperFamilySSF1406121.12E-14203250IPR004953EB1, C-terminal
PfamPF032718.6E-14221250IPR004953EB1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008017Molecular Functionmicrotubule binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MEGSQNGSSN GLPPFLTRTY DMVDDLATNA MVSWSPSSNS FIVWNPTEFS GVLLPTYFKH  60
NNFSSFVRQL NTYFWPYIPS FEWNQAVDIT GGVDPTELDL NRNHFYHYNA LERREFCKGG  120
KEVNKKAALV NPSSKGNALG SKTATVASSQ RNDPPVPVVN VAAKHSRTGS NAGYGSVPFQ  180
TTSTEPPFYG SAMPNTASAN AAQIEALNEQ VIELKLSVDS LEKERDFYFA KLRDIEILCQ  240
NPDVEQLPLL RASIGLYGLL PSSVGILPSP CGLFKPQWA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B9e-177822296Heat shock factor protein 1
5d5v_B9e-177822296Heat shock factor protein 1
5d5v_D9e-177822296Heat shock factor protein 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17750.13e-28heat shock factor 1